missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 16108810

C1orf57, Rabbit anti-Human, Polyclonal Antibody, Abnova™

Produktkod. 16108810
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Förpackningsstorlek:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
16108810 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16108810 Leverantör Abnova Leverantörsnummer PAB31553.100uL

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

Sequence: LRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKPLALVEEIRN

Specifikationer

Antigen C1orf57
Användningsområden Immunohistochemistry (Paraffin), Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
Formulering In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gen chromosome 1 open reading frame 57
Gene Alias FLJ11383/MGC13186/RP4-678E16.2
Gensymboler C1orf57
Värd art Rabbit
Immunogen Recombinant protein corresponding to human C1orf57.
Kvantitet 100 μL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 84284
Målarter Human
Innehåll och lagring Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Form Liquid
Isotyp IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.