missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ C22orf1 (Human) Recombinant Protein

Human C22orf1 full-length ORF ( AAH28035, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000758-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16162471

  • 6150.00 SEK / 25µg
Estimated Shipment: 27-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS
Specifications

Specifications

AAH28035
metallophosphoesterase domain containing 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MPPED1
GST
758
Wheat germ expression system
25 μg
239AB, C22orf1, FAM1A, MGC88045
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers