C3orf67 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-57722

Se fler versioner av denna produkt

Produktkod. 18225664

5960.00 SEK / 100µL

Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

C3orf67 Polyclonal specifically detects C3orf67 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifikationer

Antigen	C3orf67
Klassificering	Polyclonal
Utspädning	Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias	Chromosome 3 Open Reading Frame 67
Värd art	Rabbit
Reningsmetod	Affinity Purified
Regulatorisk status	RUO
Gen-ID (Entrez)	200844
Målarter	Human
Isotyp	IgG

Användningsområden	Western Blot, Immunocytochemistry, Immunofluorescence
Konjugera	Unconjugated
Formulering	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gensymboler	C3orf67
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IDLVAFTSEIFKGAVFQSLDGIVVSANCKLRKIFTLKSKPQDTADKDAVYGVPFSTDEPTDIIPRSCQLMTDVPHVTQLLNMTKLRQTEIKFGGHPLRSAE
Kvantitet	100 μL
Primär eller sekundär	Primary
Testspecificitet	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Innehåll och lagring	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Produktförslag

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Ditt namn

E-postadress *

Typ av ärende *

Detaljerad beskrivning av ärendet/förfrågan *

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Avbryt Skicka in

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.

For Research Use Only

Hittar du en möjlighet till förbättring?Dela en innehållskorrigering

C3orf67 Antibody, Novus Biologicals™

Beskrivning

Specifikationer

Produktförslag

Dokument

Kampanjer