missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CA11 (Human) Recombinant Protein

Human CA11 full-length ORF ( AAH02662.1, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal.

4515.00 SEK - 6845.00 SEK

Accession Number	AAH02662.1
Gene ID (Entrez)	770
Name	carbonic anhydrase XI
Preparation Method	Wheat germ expression system
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16172501 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00000770-P01.10UG	10 μg	4515.00 SEK 10µg View alternative products Save Up to »	Estimated Shipment: 23-05-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

16182501 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00000770-P01.25UG	25 μg	6845.00 SEK 25µg View alternative products Save Up to »	Estimated Shipment: 23-05-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MGAAARLSAPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGR

Specifications

Accession Number	AAH02662.1
Name	carbonic anhydrase XI
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Gene Alias	CARP2, CARPX1
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Gene ID (Entrez)	770
Preparation Method	Wheat germ expression system
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	CA11
Protein Tag	GST

Description