missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Biokemiska reagenser
  4. Peptider
  5. 18746569

Tocris Bioscience™ Calcitonin (human)
GREENER_CHOICE

Produktkod. 18746569
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
500 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18746569 500 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18746569 Leverantör Tocris Bioscience™ Leverantörsnummer 6031/500U

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Endogenous calcitonin receptor agonist; inhibits bone resorption

Calcitonin (human) is an endogenous calcitonin receptor agonist. Lowers systemic blood calcium levels and inhibits bone resorption.
TRUSTED_SUSTAINABILITY

Specifikationer

Renhet 0.95
CAS 21215-62-3
Innehåll och lagring Store at −20°C
För användning med (applikation) Endogenous calcitonin receptor agonist.
Frystorkat material Yes
Molekylvikt (g/mol) 3417.87
Produkttyp Peptide
Kvantitet 500 μg
Sekvens CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP

For Research Use Only.

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.