missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Calreticulin-2/CALR3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33390
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
Calreticulin-2/CALR3 Polyclonal specifically detects Calreticulin-2/CALR3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifikationer
| Calreticulin-2/CALR3 | |
| Polyclonal | |
| Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Q96L12 | |
| CALR3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRN | |
| 0.1 mL | |
| Cancer | |
| 125972 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| calreticulin 2, calreticulin 3, Calreticulin-2, calreticulin-3, cancer/testis antigen 93, CRT2calreticulin-2, CT93, FLJ25355, MGC26577 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering