missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 16085365

CCRK, Mouse anti-Human, Clone: 3E11, Abnova™

Produktkod. 16085365
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μg
Förpackningsstorlek:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet unitSize
16085365 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 16085365 Leverantör Abnova Leverantörsnummer H00023552M13.100ug

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Mouse Monoclonal Antibody

Sequence: FPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIA

Specifikationer

Antigen CCRK
Användningsområden ELISA, Western Blot
Klassificering Monoclonal
Klona 3E11
Konjugera Unconjugated
Formulering In 1x PBS, pH 7.4
Gen cell cycle related kinase
Genaccessionsnr. BC002655
Gene Alias CDCH/p42
Gensymboler CCRK
Värd art Mouse
Immunogen CCRK (AAH02655.1, 183 a.a. ∼ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Kvantitet 100 μg
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 23552
Målarter Human
Innehåll och lagring Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Isotyp IgG2a κ
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.