missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD1e Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-10816-100UL
This item is not returnable.
View return policy
Description
CD1e Polyclonal specifically detects CD1e in Human samples. It is validated for Western Blot.Specifications
CD1e | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
CD1e molecule, e polypeptide, FLJ17609, membrane-associated, thymocyte antigen CD1E | |
The immunogen is a synthetic peptide directed towards the middle region of human CD1e (NP_001036048.1). Peptide sequence GRLQLVCHVSGFYPKPVWVMWMRGEQEQRGTQRGDVLPNADETWYLRATL | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
913 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |