missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD1e Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4369.22 SEK
Specifications
Antigen | CD1e |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
CD1e Polyclonal specifically detects CD1e in Human samples. It is validated for Western Blot.Specifications
CD1e | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
CD1e molecule, e polypeptide, FLJ17609, membrane-associated, thymocyte antigen CD1E | |
The immunogen is a synthetic peptide directed towards the middle region of human CD1e (NP_001036048.1). Peptide sequence GRLQLVCHVSGFYPKPVWVMWMRGEQEQRGTQRGDVLPNADETWYLRATL | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
913 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |