missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CD36 (Human) Recombinant Protein

Human CD36 full-length ORF ( NP_000063.2, 1 a.a. - 472 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000948-P02.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16116147

  • 6150.00 SEK / 25µg
Estimated Shipment: 28-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
Specifications

Specifications

NP_000063.2
CD36 molecule (thrombospondin receptor)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD36
GST
948
Wheat germ expression system
25 μg
CHDS7, FAT, GP3B, GP4, GPIV, PASIV, SCARB3
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers