missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CD48 (Human) Recombinant Protein
Human CD48 full-length ORF ( AAH30224, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.
4515.00 SEK - 6845.00 SEK
Specifications
| Accession Number | AAH30224 |
|---|---|
| Gene ID (Entrez) | 962 |
| Name | CD48 molecule |
| Preparation Method | Wheat germ expression system |
| Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16122891
|
Abnova™
H00000962-P01.10UG |
10 μg |
4515.00 SEK
10µg |
Estimated Shipment: 21-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16132891
|
Abnova™
H00000962-P01.25UG |
25 μg |
6845.00 SEK
25µg |
Estimated Shipment: 21-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
- Sequence: MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLGESGEPKSKSPLQWPQMDHCRASWEAWGTLGEEERKTSGQV
Specifications
| AAH30224 | |
| CD48 molecule | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| BCM1, BLAST, BLAST1, MEM-102, SLAMF2, hCD48, mCD48 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 962 | |
| Wheat germ expression system | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CD48 | |
| GST |