missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CD48 (Human) Recombinant Protein

Human CD48 full-length ORF ( AAH30224, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00000962-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16132891

  • 5030.41 SEK / 25µg

Estimated Shipment: 18-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLGESGEPKSKSPLQWPQMDHCRASWEAWGTLGEEERKTSGQV
Specifications

Specifications

AAH30224
CD48 molecule
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD48
GST
962
Wheat germ expression system
25 μg
BCM1, BLAST, BLAST1, MEM-102, SLAMF2, hCD48, mCD48
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates