missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. CD8 Antibody (CL1529), Novus Biologicals™

CD8 Antibody (CL1529), Novus Biologicals™

Produktkod. 18608625 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
25 μL
0.1 mL
Förpackningsstorlek:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet Förpackningsstorlek
18608625 25 μL -
18173519 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18608625 Leverantör Novus Biologicals Leverantörsnummer NBP23674325ul
 Begränsad artikel
Beräknad leverans: 01-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Mouse Monoclonal Antibody

CD8 Monoclonal specifically detects CD8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen CD8
Användningsområden Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassificering Monoclonal
Klona CL1529
Konjugera Unconjugated
Utspädning Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Genaccessionsnr. P01732
Gene Alias CD8, CD8a molecule, LEU2, p32
Gensymboler CD8A
Värd art Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT
Reningsmetod Protein A purified
Kvantitet 25 μL
Regulatorisk status RUO
Forskningsdisciplin Innate Immunity
Primär eller sekundär Primary
Gen-ID (Entrez) 925
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Rekonstitution Protein A purified
Målarter Human
Innehåll och lagring Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG1
Produktlinje Novus
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.