missing translation for 'onlineSavingsMsg'
Learn More

CD83 Recombinant Protein, Abnova

Brand:  Abnova H00009308-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16123512

  • 5854.80 SEK / 25µg
Estimated Shipment: 07-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH30830
Solution
9308
CD83 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD83
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
48.29
8
Glutathione Sepharose 4 Fast Flow
25 ug
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
BL11/HB15
CD83
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers