missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CDK5 (Human) Recombinant Protein

Name: Abnova&trade; CDK5 (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16163021
Price: 6845.00 EUR

Human CDK5 full-length ORF ( NP_004926.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00001020-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16163021

Estimated Shipment: 21-05-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

Specifications

Accession Number	NP_004926.1
Name	cyclin-dependent kinase 5
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	CDK5
Protein Tag	GST

Gene ID (Entrez)	1020
Preparation Method	Wheat germ expression system
Quantity	25 μg
Gene Alias	PSSALRE
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description