missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CEACAM8 (Human) Recombinant Protein

Human CEACAM8 full-length ORF ( AAH26263, 1 a.a. - 349 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001088-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16116244

  • 5854.80 SEK / 25µg
Estimated Shipment: 07-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI
Specifications

Specifications

AAH26263
carcinoembryonic antigen-related cell adhesion molecule 8
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CEACAM8
GST
1088
Wheat germ expression system
25 μg
CD66b, CD67, CGM6, NCA-95
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers