Abnova™ CIRBP (Human) Recombinant Protein

Human CIRBP full-length ORF ( AAH00403, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

4515.00 SEK - 6845.00 SEK

Accession Number	AAH00403
Gene ID (Entrez)	1153
Name	cold inducible RNA binding protein
Preparation Method	Wheat germ expression system
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue

Ver más especificaciones

Productos 2

Código de producto	Marca	Quantity	Precio	Cantidad y disponibilidad
Código de producto	Marca	Quantity	Precio	Cantidad y disponibilidad
16183221 missing translation for 'viewDocuments' Detalles de la promoción missing translation for 'viewProductCertificates'	Abnova™ H00001153-P02.10UG	10 μg	4515.00 SEK 10µg Ver productos alternativos missing translation for 'toSaveUpto' »	Estimated Shipment: 14-06-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

16193221 missing translation for 'viewDocuments' Detalles de la promoción missing translation for 'viewProductCertificates'	Abnova™ H00001153-P02.25UG	25 μg	6845.00 SEK 25µg Ver productos alternativos missing translation for 'toSaveUpto' »	Estimated Shipment: 14-06-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

Descripción

Sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE

Especificaciones

Accession Number	AAH00403
Name	cold inducible RNA binding protein
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Gene Alias	CIRP
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Gene ID (Entrez)	1153
Preparation Method	Wheat germ expression system
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	CIRBP
Protein Tag	GST

Descripción