missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CIRBP (Human) Recombinant Protein

Human CIRBP full-length ORF ( AAH00403, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001153-P02.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16183221

  • 3343.96 SEK / 10µg

Estimated Shipment: 30-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Specifications

Specifications

AAH00403
cold inducible RNA binding protein
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CIRBP
GST
1153
Wheat germ expression system
10 μg
CIRP
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates