missing translation for 'onlineSavingsMsg'
Learn More

Print

Abnova™ COMT (Human) Recombinant Protein

Human COMT full-length ORF ( AAH00419.2, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal.

4055.00 SEK - 6150.00 SEK

Specifications

Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene ID (Entrez)	1312

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16163401 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00001312-P01.10UG	10 μg	4055.00 SEK 10µg View alternative products Save Up to »	Estimated Shipment: 04-08-2022 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!
16173401 View Documents Promotion Details missing translation for 'viewProductCertificates'	Abnova™ H00001312-P01.25UG	25 μg	6150.00 SEK 25µg View alternative products Save Up to »	Estimated Shipment: 04-08-2022 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

Description

Description

Sequence: MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP

Specifications

Specifications

Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene ID (Entrez)	1312

Back to Top