missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. COX7A1 Antibody - Azide and BSA Free, R&D Systems™

COX7A1 Antibody - Azide and BSA Free, R&D Systems™

Produktkod. 18603710 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
0.02 mL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18603710 0.1 mL
18631621 0.02 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18603710 Leverantör Novus Biologicals Leverantörsnummer NBP2921850.1ml
 Begränsad artikel
Beräknad leverans: 03-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

COX7A1 Polyclonal specifically detects COX7A1 in Human, Mouse, Rat samples. It is validated for ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen COX7A1
Användningsområden ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Western Blot 1:100 - 1:500, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Formulering PBS with 50% glycerol, pH7.3.
Gene Alias COX7AHCOX7A, COX7AM, cytochrome c oxidase subunit VIIa heart/muscle isoform, cytochrome c oxidase subunit VIIa polypeptide 1 (muscle), Cytochrome c oxidase subunit VIIa-H, Cytochrome c oxidase subunit VIIa-M, Cytochrome c oxidase subunit VIIa-muscle, mitochondrial
Värd art Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-79 of human COX7A1 (NP_001855.1). MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN
Reningsmetod Affinity purified
Kvantitet 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Cardiovascular Biology, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Primär eller sekundär Primary
Gen-ID (Entrez) 1346
Målarter Human, Mouse, Rat
Innehåll och lagring Store at -20°C. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG
Produktlinje Novus
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.