missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CSTF3 (Human) Recombinant Protein
Human CSTF3 full-length ORF ( AAH09792, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.
4515.00 SEK - 6845.00 SEK
Specifications
| Accession Number | AAH09792 |
|---|---|
| Gene ID (Entrez) | 1479 |
| Name | cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa |
| Preparation Method | Wheat germ expression system |
| Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16183681
|
Abnova™
H00001479-P01.10UG |
10 μg |
4515.00 SEK
10µg |
Estimated Shipment: 29-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16193681
|
Abnova™
H00001479-P01.25UG |
25 μg |
6845.00 SEK
25µg |
Estimated Shipment: 29-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
- Sequence: MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN
Specifications
| AAH09792 | |
| cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| CSTF-77, MGC117398, MGC43001, MGC75122 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 1479 | |
| Wheat germ expression system | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CSTF3 | |
| GST |