missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CSTF3 (Human) Recombinant Protein
Human CSTF3 full-length ORF ( AAH09792, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00001479-P01.10ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN
Specifications
| AAH09792 | |
| cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CSTF3 | |
| GST |
| 1479 | |
| Wheat germ expression system | |
| 10 μg | |
| CSTF-77, MGC117398, MGC43001, MGC75122 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |