missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
CtIP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
5655.00 SEK
Specifikationer
| Antigen | CtIP |
|---|---|
| Användningsområden | Immunocytochemistry, Immunofluorescence |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Värd art | Rabbit |
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|
18280004
|
Novus Biologicals
NBP2-55651 |
100 μL |
5655.00 SEK
100µL |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
Beskrivning
CtIP Polyclonal specifically detects CtIP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifikationer
| CtIP | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CtBP-interacting protein, CtIP, DNA endonuclease RBBP8, EC 3.1, RBBP-8, retinoblastoma binding protein 8, Retinoblastoma-binding protein 8, Retinoblastoma-interacting protein and myosin-like, RIMSAE2, Sporulation in the absence of SPO11 protein 2 homolog | |
| RBBP8 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5932 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FSAIQRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASDGNCTLPKDSPGEPCSQECIILQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel