missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CTSW (Human) Recombinant Protein

Name: Abnova&trade; CTSW (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16183771
Price: 4515.00 EUR

Human CTSW full-length ORF ( AAH48255, 22 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00001521-P01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16183771

Estimated Shipment: 29-05-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: IRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEHAHRLDIFAHNLAQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGNIETLWRISFWDFVDVSVQELLDCGRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGKVRAHRCHPKKYQKVAWIQDFIMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKATPTTCDPQLVDHSVLLVGFGSVKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSNTCGITKFPLTARVQKPDMKPRVSCPP

Specifications

Accession Number	AAH48255
Name	cathepsin W
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	CTSW
Protein Tag	GST

Gene ID (Entrez)	1521
Preparation Method	Wheat germ expression system
Quantity	10 μg
Gene Alias	LYPN
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description