missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
CXXC5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
5455.00 SEK
Specifikationer
| Antigen | CXXC5 |
|---|---|
| Utspädning | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Användningsområden | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|
18242286
|
Novus Biologicals
NBP1-81675 |
0.1 mL |
5455.00 SEK
0.10ml |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
Beskrivning
CXXC5 Polyclonal specifically detects CXXC5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifikationer
| CXXC5 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| CF5, CXXC finger 5, CXXC finger 5 protein, CXXC finger protein 5, CXXC-type zinc finger protein 5, HSPC195, Putative MAPK-activating protein PM08, Putative NF-kappa-B-activating protein 102, retinoid-inducible nuclear factor, RINF, WID, WT1-induced Inhibitor of Dishevelled | |
| CXXC5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 51523 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PDMEAVAGAEALNGQSDFPYLGAFPINPGLFIMTPAGVFLAESALHMAGLAEYPMQGELASAISSGKKKRK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title