missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 18294011

CYP3A43 Antibody, Novus Biologicals™

Produktkod. 18294011 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18294011 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18294011 Leverantör Novus Biologicals Leverantörsnummer NBP169413

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

CYP3A43 Polyclonal specifically detects CYP3A43 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen CYP3A43
Användningsområden Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassificering Polyclonal
Koncentration 0.5 mg/ml
Konjugera Unconjugated
Utspädning Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulering PBS, 2% Sucrose with 0.09% Sodium Azide
Genaccessionsnr. Q9HB55
Gene Alias cytochrome P450 3A43, cytochrome P450 polypeptide 43, cytochrome P450, family 3, subfamily A, polypeptide 43, cytochrome P450, subfamily IIIA, polypeptide 43, EC 1.14.14.1, MGC119315, MGC119316
Gensymboler CYP3A43
Värd art Rabbit
Immunogen Synthetic peptides corresponding to CYP3A43(cytochrome P450, family 3, subfamily A, polypeptide 43) The peptide sequence was selected from the C terminal of CYP3A43. Peptide sequence IYALHHDPKYWTEPEKFCPESRFSKKNKDSIDLYRYIPFGAGPRNCIGMR.
Molekylvikt av antigen 58 kDa
Reningsmetod Affinity purified
Kvantitet 100 μL
Regulatorisk status RUO
Forskningsdisciplin Lipid and Metabolism, Prostate Cancer
Primär eller sekundär Primary
Gen-ID (Entrez) 64816
Testspecificitet Canine: 86%; Goat: 85%; Mouse: 85%; Guinea pig: 80%.
Rekonstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Målarter Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep
Innehåll och lagring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotyp IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.