missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Cytosolic Sulfotransferase 2B1/SULT2B1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
7005.00 SEK
Specifikationer
| Antigen | Cytosolic Sulfotransferase 2B1/SULT2B1 |
|---|---|
| Utspädning | Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Användningsområden | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|
18321644
|
Novus Biologicals
NBP3-16997-100UL |
100 μg |
7005.00 SEK
100µL |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
Beskrivning
Cytosolic Sulfotransferase 2B1/SULT2B1 Polyclonal antibody specifically detects Cytosolic Sulfotransferase 2B1/SULT2B1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifikationer
| Cytosolic Sulfotransferase 2B1/SULT2B1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| metabolism | |
| PBS, pH 7.2, 40% glycerol | |
| 6820 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Alcohol sulfotransferase, EC 2.8.2, EC 2.8.2.2, HSST2sulfotransferase family cytosolic 2B member 1, Hydroxysteroid sulfotransferase 2, ST2B1, Sulfotransferase 2B1, sulfotransferase family, cytosolic, 2B, member 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KAKVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDH | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel