missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Biokemiska reagenser
  4. Peptider
  5. 18796556

Tocris Bioscience™ [D-Ala2]-GIP (human)
GREENER_CHOICE

Produktkod. 18796556
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
1 mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18796556 1 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18796556 Leverantör Tocris Bioscience™ Leverantörsnummer 6699/1

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Highly potent GIP agonist

[D-Ala2]-GIP (human) is a highly potent GIP receptor agonist (EC50 = 630 ± 119 pM). Displays equivalent cAMP stimulating properties and improved resistance to enzymatic degradation compared to native GIP (Cat. No. 2084) in cells expressing wild type GIP receptor. Improves glucose tolerance, insulin release and cognitive function in various animal models of obesity and diabetes. Displays neuroprotective effects in an MPTP model of PD.
TRUSTED_SUSTAINABILITY

Specifikationer

Renhet 95%
CAS 444073-04-5
Innehåll och lagring Store at -20°C
Beskrivning GIP receptor agonist
Formulering C226H338N60O66S
Molekylvikt (g/mol) 4983.58
Kvantitet 1 mg
Sekvens YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ (Modifications: Ala-2 = D-Ala)
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.