missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. DAAM2 Antibody, R&D Systems™

DAAM2 Antibody, R&D Systems™

Produktkod. 18600978 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Kvantitet
18600978 0.1 mL
18629417 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18600978 Supplier Novus Biologicals Supplier No. NBP249141
  • ONLINE EXCLUSIVE PRICE
    6067.01 SEK
    5634.30 SEK / 0.1ml
    Save 432.71 SEK
    7% Av
 Begränsad artikel
Beräknad leverans: 01-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

DAAM2 Polyclonal antibody specifically detects DAAM2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen DAAM2
Användningsområden Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulering PBS (pH 7.2), 40% Glycerol
Gene Alias dishevelled associated activator of morphogenesis 2
Värd art Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: RKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDEL
Reningsmetod Immunogen affinity purified
Kvantitet 0.1 mL
Regulatorisk status RUO
Forskningsdisciplin Stem Cells
Primär eller sekundär Primary
Gen-ID (Entrez) 23500
Målarter Human
Innehåll och lagring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG
Produktlinje Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.