missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biokemiska reagenser
  4. Peptider
  5. 18255234

Novus Biologicals™ DCPS Recombinant Protein Antigen

Code produit. 18255234 Tous les produits Bio Techne Produits
Click to view available options
Kvantitet:
100 μL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 18255234

Marque: Novus Biologicals™ NBP256249PEP

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DCPS. Source: E.coli Amino Acid Sequence: QFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVY The DCPS Recombinant Protein Antigen is derived from E. coli. The DCPS Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Spécification

Gen-ID (Entrez) 28960
Reningsmetod >80% by SDS-PAGE and Coomassie blue staining
Vanligt namn DCPS Recombinant Protein Antigen
Innehåll och lagring Store at −20°C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
För användning med (applikation) Blocking/Neutralizing, Control
Gene Alias DCS1, DCS-1, decapping enzyme, scavenger, EC 3.-, heat shock-like protein 1, HINT5, HINT-5homolog of C. elegans 7meGMP-directed hydrolase dcs-1, Hint-related 7meGMP-directed hydrolase, Histidine triad protein member 5, HSL1, HSPC015, mRNA decapping enzyme
Gensymbol DCPS
Etiketttyp Unlabeled
Produkttyp Recombinant Protein Antigen
Kvantitet 100 μL
Regulatorisk status RUO
Källa E.Coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52282. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Afficher plus Afficher moins

For Research Use Only.

Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis