missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ DDIT3 (Human) Recombinant Protein

Human DDIT3 full-length ORF ( AAH03637.1, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001649-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16117017

  • 3860.70 SEK / 10µg
Estimated Shipment: 27-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
Specifications

Specifications

AAH03637.1
DNA-damage-inducible transcript 3
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DDIT3
GST
1649
Wheat germ expression system
10 μg
CEBPZ, CHOP, CHOP10, GADD153, MGC4154
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers