missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. Abnova™ DGKE Recombinant Protein

Abnova™ DGKE Recombinant Protein

Produktkod. 16152532
Klicka för att se tillgängliga alternativ
Kvantitet:
10 μg
25 μg
Förpackningsstorlek:
10µg
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 16152532

Brand: Abnova™ H00008526P01.10ug

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spécification

Tillträdesnummer AAH22297
För användning med (applikation) Antibody Production, Protein Array, ELISA, Western Blot
Formulering 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gen-ID (Entrez) 8526
Molekylvikt (g/mol) 45.21
Namn DGKE (Human) Recombinant Protein (P01)
pH-intervall 8
Beredningsmetod In vitro wheat germ expression system
Reningsmetod Glutathione Sepharose 4 Fast Flow
Kvalitetskontrolltestning 12.5% SDS-PAGE Stained with Coomassie Blue.
Kvantitet 10 μg
Källa Wheat Germ (in vitro)
Immunogen MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRRDIFRKSKHGWRDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRYGLRGHSLSQNAPWESGFHRVV
Förvaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias DAGK6/DGK
Vanligt namn DGKE
Gensymbol DGKE
Korsreaktivitet Human
Art Wheat Germ (in vitro)
Rekombinant Recombinant
Protein Tag GST
Form Solution
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis