missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. Abnova™ DLX2 (Human) Recombinant Protein

Abnova™ DLX2 (Human) Recombinant Protein

Produktkod. 16033905
Klicka för att se tillgängliga alternativ
Kvantitet:
10 μg
25 μg
Förpackningsstorlek:
10µg
25µg
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 16033905

Brand: Abnova™ H00001746Q02.10ug

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Se alternativa produkter

Denna artikel kan inte returneras. Se returpolicy

Description

Human DLX2 partial ORF (NP_004396.1, 1 a.a. - 110 a.a.) recombinant protein with GST tag at N-terminal.

  • Sequence: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDL

Specifications

Tillträdesnummer NP_004396.1
Gen-ID (Entrez) 1746
Namn distal-less homeobox 2
Beredningsmetod Wheat germ expression system
Kvalitetskontrolltestning 125% SDS-PAGE Stained with Coomassie Blue
Kvantitet 10 μg
Förvaringskrav Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias TES-1, TES1
Gensymbol DLX2
Art Wheat Germ (in vitro)
Protein Tag GST
Buffert 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.