missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ DLX2 (Human) Recombinant Protein

Human DLX2 partial ORF (NP_004396.1, 1 a.a. - 110 a.a.) recombinant protein with GST tag at N-terminal.

4055.00 SEK - 6150.00 SEK

Specifications

Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene ID (Entrez) 1746
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16033905
View Documents Promotion Details
Abnova™
H00001746-Q02.10UG
10 μg
4055.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 06-10-2022
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16043905
View Documents Promotion Details
Abnova™
H00001746-Q02.25UG
25 μg
6150.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 06-10-2022
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

  • Sequence: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDL
Specifications

Specifications

Store at -80°C. Aliquot to avoid repeated freezing and thawing.
1746
SDS
Product Certifications