missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. 18205874

EME1 Antibody, Novus Biologicals™

Produktkod. 18205874 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18205874 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18205874 Leverantör Novus Biologicals Leverantörsnummer NBP155350

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

EME1 Polyclonal specifically detects EME1 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen EME1
Användningsområden Western Blot
Klassificering Polyclonal
Koncentration 0.5 mg/ml
Konjugera Unconjugated
Utspädning Western Blot 1.0 ug/ml
Formulering PBS, 2% Sucrose with 0.09% Sodium Azide
Genaccessionsnr. Q96AY2
Gene Alias crossover junction endonuclease EME1, EC 3.1.22, EC 3.1.22.-, essential meiotic endonuclease 1 homolog 1 (S. pombe), essential meiotic endonuclease 1 homolog 2, FLJ31364, hMMS4, homolog of yeast EME1 endonuclease, MMS4, MMS4 homolog, MMS4L, SLX2 structure-specific endonuclease subunit homolog A, SLX2A
Gensymboler EME1
Värd art Rabbit
Immunogen Synthetic peptides corresponding to EME1(essential meiotic endonuclease 1 homolog 1 (S. pombe)) The peptide sequence was selected from the middle region of EME1. Peptide sequence AYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRR.
Molekylvikt av antigen 63 kDa
Reningsmetod Affinity purified
Kvantitet 100 μL
Regulatorisk status RUO
Forskningsdisciplin DNA Repair, Homologous Recombination
Primär eller sekundär Primary
Gen-ID (Entrez) 146956
Rekonstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Målarter Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
Innehåll och lagring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotyp IgG
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.