missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. ErbB2/Her2 Antibody, R&D Systems™

ErbB2/Her2 Antibody, R&D Systems™

Produktkod. 18476140 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18476140 25 μL
18420501 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18476140 Leverantör Novus Biologicals Leverantörsnummer NBP18458425ul
 Begränsad artikel
Beräknad leverans: 01-12-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

ErbB2/Her2 Polyclonal specifically detects ErbB2/Her2 in Human, Mouse samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen ErbB2/Her2
Användningsområden Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulering PBS (pH 7.2) and 40% Glycerol
Gene Alias CD340, CD340 antigen, c-erb B2/neu protein, EC 2.7.10, EGFR2, HER-2, HER2EC 2.7.10.1, herstatin, Metastatic lymph node gene 19 protein, MLN 19, MLN19, NEUHER-2/neu, neuroblastoma/glioblastoma derived oncogene homolog, NGLTKR1, p185erbB2, Proto-oncogene c-ErbB-2, Proto-oncogene Neu, receptor tyrosine-protein kinase erbB-2, Tyrosine kinase-type cell surface receptor HER2, v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2(neuro/glioblastoma derived oncogene homolog), v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastomaderived oncogene homolog (avian)
Värd art Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTA
Reningsmetod Immunogen affinity purified
Kvantitet 25 μL
Regulatorisk status RUO
Forskningsdisciplin Breast Cancer, Cancer, Cellular Markers, Core ESC Like Genes, Oncogenes, Phospho Specific, Protein Kinase, Stem Cell Markers, Tumor Suppressors
Primär eller sekundär Primary
Gen-ID (Entrez) 2064
Målarter Human, Mouse
Innehåll och lagring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Form Purified
Isotyp IgG
Produktlinje Novus
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.