missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Specifikationer
Specifikationer
| Värd art | Human, Mouse, Rat, Hamster, Rabbit, Xenopus |
| Komponenter | ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 |
| För användning med (applikation) | Inhibition of Erk activation |
| Innehåll och lagring | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
| Kvantitet | 5 mg |
| Produkttyp | ERK1 Inhibitor Peptide Set |
| Molekylvikt (g/mol) | 3795 |
| Inhibitorer | ERK1 |
| Form | Lyophilized |
For Research Use Only
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?