missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Anpassade produkter och tjänster
  4. Anpassade enzymer och inhibitorer
  5. Novus Biologicals™ ERK1 Inhibitor Peptide Set

Novus Biologicals™ ERK1 Inhibitor Peptide Set

Produktkod. 18116222 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
2 mg
5 mg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18116222 2 mg
18110564 5 mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18116222 Leverantör Novus Biologicals™ Leverantörsnummer NBP229333

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

For use in research applications

TRUSTED_SUSTAINABILITY

Specifikationer

Värd art Human, Mouse, Rat, Hamster, Rabbit, Xenopus
Komponenter ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
För användning med (applikation) Inhibition of Erk activation
Innehåll och lagring Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Kvantitet 2 mg
Produkttyp ERK1 Inhibitor Peptide Set
Molekylvikt (g/mol) 3795
Inhibitorer ERK1
Form Lyophilized

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.