missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
FABP7/B-FABP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP1-88648
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
FABP7/B-FABP Polyclonal specifically detects FABP7/B-FABP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifikationer
| FABP7/B-FABP | |
| Polyclonal | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FABP7 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCK | |
| 0.1 mL | |
| Cell Cycle and Replication, Stem Cells | |
| 2173 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.1mg/mL | |
| Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:50-1:200 | |
| B-FABPDKFZp547J2313, BLBPMRG, Brain lipid-binding protein, Brain-type fatty acid-binding protein, FABPBbrain lipid binding protein, fatty acid binding protein 7, brain, Fatty acid-binding protein 7, fatty acid-binding protein, brain, Mammary-derived growth inhibitor related, mammary-derived growth inhibitor-related | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering