missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. FAM123C Antibody, Novus Biologicals™

FAM123C Antibody, Novus Biologicals™

Produktkod. 18602906 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
25 μL
0.1 mL
Förpackningsstorlek:
0.1ml
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet Förpackningsstorlek
18602906 25 μL -
18118568 0.1 mL 0.1ml
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18602906 Leverantör Novus Biologicals Leverantörsnummer NBP23871925ul
  • ONLINE EXCLUSIVE PRICE
    4441.54 SEK
    3748.50 SEK / 25µL
    Save 693.04 SEK
    15% Av
 Begränsad artikel
Beräknad leverans: 02-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

FAM123C Polyclonal specifically detects FAM123C in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen FAM123C
Användningsområden Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Genaccessionsnr. Q8N944
Gene Alias family with sequence similarity 123C
Gensymboler AMER3
Värd art Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: SDFTRFWDSVNRSVRQQQRALLGPWLSGPQGTDRDQPRLDTAGLAELPLCPCRDPRSGSKASSIDTGTPKSEQPESVSTS
Reningsmetod Affinity Purified
Kvantitet 25 μL
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 205147
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Innehåll och lagring Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Produkttyp Antibody
Isotyp IgG
Produktlinje Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.