missing translation for 'onlineSavingsMsg'
Learn More

FAM193B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-17364-100UL

Product Code. 18324074

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

FAM193B Polyclonal antibody specifically detects FAM193B in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	FAM193B
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias	DKFZp313I142, family with sequence similarity 193, member B, KIAA1931
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: NTVPNLSRVIWVKTPKPGYPSSEEPSSKEVPSCKQELPEPVSSGGKPQKGKRQGSQAKKSEASPAPRPPASLEVPSAKGQVAGPKQ
Quantity	100 μg
Research Discipline	Cancer, Cell Cycle and Replication
Gene ID (Entrez)	54540
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description