missing translation for 'onlineSavingsMsg'
Läs mer

FAM222A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Produktkod. 18337234 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18337234 100 μg
18350045 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18337234 Leverantör Novus Biologicals Leverantörsnummer NBP317365100UL

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Rabbit Polyclonal Antibody

FAM222A Polyclonal antibody specifically detects FAM222A in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen FAM222A
Användningsområden Immunofluorescence
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulering PBS, pH 7.2, 40% glycerol
Gene Alias C12orf34, chromosome 12 open reading frame 34, FLJ14721, hypothetical protein LOC84915
Värd art Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: QPLRAYSGSTVASKSPEACGGRAYERASGSPLNCGVGLPTSFTVGQYFAAPWNSVLVTPTSDCYNPA
Reningsmetod Affinity purified
Kvantitet 100 μg
Regulatorisk status RUO
Primär eller sekundär Primary
Gen-ID (Entrez) 84915
Målarter Human
Innehåll och lagring Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotyp IgG
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.