missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
Beskrivning
FAM222A Polyclonal antibody specifically detects FAM222A in Human samples. It is validated for Immunofluorescence
Specifikationer
Specifikationer
| Antigen | FAM222A |
| Användningsområden | Immunofluorescence |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Utspädning | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulering | PBS, pH 7.2, 40% glycerol |
| Gene Alias | C12orf34, chromosome 12 open reading frame 34, FLJ14721, hypothetical protein LOC84915 |
| Värd art | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QPLRAYSGSTVASKSPEACGGRAYERASGSPLNCGVGLPTSFTVGQYFAAPWNSVLVTPTSDCYNPA |
| Reningsmetod | Affinity purified |
| Visa mer |
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?