missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM222A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
3675.00 SEK - 5775.00 SEK
Specifications
| Antigen | FAM222A |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18350045
|
Bio-Techne
NBP3-17365-25UL |
25 μg |
3675.00 SEK
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18337234
|
Bio-Techne
NBP3-17365-100UL |
100 μg |
5775.00 SEK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FAM222A Polyclonal antibody specifically detects FAM222A in Human samples. It is validated for ImmunofluorescenceSpecifications
| FAM222A | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human | |
| C12orf34, chromosome 12 open reading frame 34, FLJ14721, hypothetical protein LOC84915 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: QPLRAYSGSTVASKSPEACGGRAYERASGSPLNCGVGLPTSFTVGQYFAAPWNSVLVTPTSDCYNPA | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 84915 | |
| IgG | |
| Affinity purified |