missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FATE1 (Human) Recombinant Protein

Human FATE1 full-length ORF (BAB71454.1, 1 a.a. - 183 a.a.) recombinant protein with GST tag at N-terminal.

Brand:  Abnova™ H00089885-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16116433

  • 6150.00 SEK / 25µg
Estimated Shipment: 14-07-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ
Specifications

Specifications

BAB71454.1
fetal and adult testis expressed 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FATE1
GST
89885
Wheat germ expression system
25 μg
FATE
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers