missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FGF16 (Human) Recombinant Protein

Human FGF16 full-length ORF ( NP_003859.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00008823-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16182942

  • 3343.96 SEK / 10µg

Estimated Shipment: 03-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Specifications

Specifications

NP_003859.1
fibroblast growth factor 16
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
8823
Wheat germ expression system
10 μg
FGF16
GST
Videos
SDS
Documents
Certificates