missing translation for 'onlineSavingsMsg'
Learn More
Learn More
-Immunohistochemistry-Paraffin-NBP3-15843-img0001.jpg-650.jpg)
-Immunohistochemistry-Paraffin-NBP3-15843-img0002.jpg-650.jpg)
-Immunohistochemistry-Paraffin-NBP3-15843-img0003.jpg-650.jpg)
-Western-Blot-NBP3-15843-img0004.jpg-650.jpg)
Fibrinopeptide A Rabbit anti-Human, Mouse, Rat, Clone: 7K8J1, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Bio-Techne NBP3-15843-100UL
This item is not returnable.
View return policy
Description
Fibrinopeptide A Monoclonal antibody specifically detects Fibrinopeptide A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Fibrinopeptide A | |
| Monoclonal | |
| Unconjugated | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 7K8J1 | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Fib2, fibrinogen alpha chain, fibrinogen, A alpha polypeptide, MGC119422, MGC119423, MGC119425 | |
| A synthetic peptide corresponding to a sequence within amino acids 700-800 of human Fibrinopeptide A (FGA) (P02671). NDEGEGEFWLGNDYLHLLTQRGSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCA | |
| 100 μg | |
| Cell Cycle and Replication | |
| 2243 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |