missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Biokemiska reagenser
  4. Peptider
  5. 18204321

Novus Biologicals™ FIH-1/HIF-1AN Recombinant Protein Antigen

Produktkod. 18204321 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μl
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18204321 100 μl
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18204321 Leverantör Novus Biologicals™ Leverantörsnummer NBP258365PEP

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FIH-1/HIF-1AN. Source: E.coli Amino Acid Sequence: KGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQE The FIH-1/HIF-1AN Recombinant Protein Antigen is derived from E. coli. The FIH-1/HIF-1AN Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifikationer

Gen-ID (Entrez) 55662
Reningsmetod >80% by SDS-PAGE and Coomassie blue staining
Vanligt namn FIH-1/HIF-1AN Recombinant Protein Antigen
Innehåll och lagring Store at −20C. Avoid freeze-thaw cycles.
Formulering PBS and 1M Urea, pH 7.4.
För användning med (applikation) Blocking/Neutralizing, Control
Gene Alias DKFZp762F1811, EC 1.14.11.16, factor inhibiting HIF1, Factor inhibiting HIF-1, FIH1FIH-1, FLJ20615, FLJ22027, hypoxia inducible factor 1, alpha subunit inhibitor, hypoxia-inducible factor 1-alpha inhibitor, Hypoxia-inducible factor asparagine hydroxylase,
Gensymbol HIF1AN
Etiketttyp Unlabeled
Produkttyp Recombinant Protein Antigen
Kvantitet 100 μl
Regulatorisk status RUO
Källa E.Coli
Specifik reaktivitet This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51585. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.