missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Antikroppar
  4. Primära antikroppar
  5. Alla primära antikroppar
  6. FKBP14 Antibody, Novus Biologicals™

FKBP14 Antibody, Novus Biologicals™

Produktkod. 18458500 Handla allt Bio Techne Produkter
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
18458500 25 μL
18297987 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 18458500 Leverantör Novus Biologicals Leverantörsnummer NBP18389125ul
 Begränsad artikel
Beräknad leverans: 10-11-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Rabbit Polyclonal Antibody

FKBP14 Polyclonal specifically detects FKBP14 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifikationer

Antigen FKBP14
Användningsområden Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassificering Polyclonal
Konjugera Unconjugated
Utspädning Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulering PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias 22 kDa FK506-binding protein, EC 5.2.1.8, FK506 binding protein 14 (22 kDa), FK506 binding protein 14, 22 kDa, FK506-binding protein 14, FKBP-14, FKBP-22, FKBP22PPIase FKBP14, FLJ20731, peptidyl-prolyl cis-trans isomerase FKBP14,22 kDa FKBP, rotamase
Gensymboler FKBP14
Värd art Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVG
Reningsmetod Affinity Purified
Kvantitet 25 μL
Regulatorisk status RUO
Forskningsdisciplin Developmental Biology
Primär eller sekundär Primary
Gen-ID (Entrez) 55033
Testspecificitet Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Målarter Human
Innehåll och lagring Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Produkttyp Antibody
Isotyp IgG
Produktlinje Novus
Visa mer Visa mindre

For Research Use Only

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.