missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FKBP7 Recombinant Protein

Name: Abnova&trade; FKBP7 Recombinant Protein
Brand: Abnova&trade;
SKU: 16120243
Price: 4515.00 EUR

Brand: Abnova™ H00051661-P01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16120243

Estimated Shipment: 23-05-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH09711.1
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	50.05
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Immunogen	MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL
Gene Alias	FKBP23/MGC9420/PPIase
Gene Symbol	FKBP7
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	51661
Name	FKBP7 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	FKBP7
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Product Suggestions

Description